Structure of PDB 7zwd Chain c

Receptor sequence

>7zwdc (length=303) Species: 9606 (Homo sapiens)

EDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSYMGHF
MKPYFKDKVTGVGPPANEDTREKAAQGIKAFEELLVTKWKNWEKALLRKS
VVSDRLQRLLQPKLLKLEYLHQKQSKVSSELERQALEKQGREAEKEIQDI
NQLPEEALLGNRLDSHDWEKISNINFEGSRSAEEIRKFWQNSEHPSINKQ
EWSREEEERLQAIAAAHGHLEWQKIAEELGTSRSAFQCLQKFQQHNKALK
RKEWTEEEDRMLTQLVQEMRVGSHIPYRRIVYYMEGRDSMQLIYRWTKSL
DPG

3D structure

• PDB: 7zwd Structural basis of SNAPc-dependent snRNA transcription initiation by RNA polymerase II.
• Chain: c
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	c	T182 K185 W187 K347 Y389	T87 K90 W92 K252 Y294
BS02	dna	c	Y141 G143 H144 P371 Y372 R373 M385 I388	Y46 G48 H49 P276 Y277 R278 M290 I293

Gene Ontology

Molecular Function

• GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
• GO:0000995 RNA polymerase III general transcription initiation factor activity
• GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0016251 RNA polymerase II general transcription initiation factor activity

Biological Process

• GO:0042795 snRNA transcription by RNA polymerase II
• GO:0042796 snRNA transcription by RNA polymerase III

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0019185 snRNA-activating protein complex

External links

• PDB: RCSB:7zwd, PDBe:7zwd, PDBj:7zwd
• PDBsum: 7zwd
• PubMed: 36424526
• UniProt: Q5SXM2|SNPC4_HUMAN snRNA-activating protein complex subunit 4 (Gene Name=SNAPC4)