Structure of PDB 7zmg Chain c |
>7zmgc (length=61) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] |
KPNITGFDMREFLRHTKTPTYDPWERHEAWRYTGRFSRFNRFKGALPGFG IATVAFTAYCV |
|
PDB | 7zmg Conformational changes in mitochondrial complex I of the thermophilic eukaryote Chaetomium thermophilum. |
Chain | c |
Resolution | 2.44 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZMP |
c |
T17 F19 |
T5 F7 |
|
|
|
|