Structure of PDB 7zmb Chain c |
>7zmbc (length=60) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] |
PNITGFDMREFLRHTKTPTYDPWERHEAWRYTGRFSRFNRFKGALPGFGI ATVAFTAYCV |
|
PDB | 7zmb Conformational changes in mitochondrial complex I of the thermophilic eukaryote Chaetomium thermophilum. |
Chain | c |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZMP |
c |
T17 F19 F24 |
T4 F6 F11 |
|
|
|
|