Structure of PDB 7wg5 Chain c

Receptor sequence

>7wg5c (length=128) Species: 3702 (Arabidopsis thaliana)

PPAVDFAFVHSVLLPDGTPDVHWRRANGGQKLRDIMLDSNIELYGPYSKP
LSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNV
GNPDSTGLVVIQQLPEWKAHEWNIPKNI

3D structure

• PDB: 7wg5 Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
• Chain: c
• Resolution: 3.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	c	Y110 C120 C126 T128 C129 C162	Y44 C54 C60 T62 C63 C96

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0140647 P450-containing electron transport chain

Cellular Component

• GO:0005829 cytosol
• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0010598 NAD(P)H dehydrogenase complex (plastoquinone)
• GO:0016020 membrane

External links

• PDB: RCSB:7wg5, PDBe:7wg5, PDBj:7wg5
• PDBsum: 7wg5
• PubMed: 35123031
• UniProt: Q9LU21|PNSB3_ARATH Photosynthetic NDH subunit of subcomplex B 3, chloroplastic (Gene Name=PNSB3)