Structure of PDB 7w3b Chain c

Receptor sequence
>7w3bc (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]
AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVF
AMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLS
GVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHE
PRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKK
SWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIK
NVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
3D structure
PDB7w3b USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
Chainc
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.19.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN c H113 H115 D126 H90 H92 D103
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
GO:0061133 endopeptidase activator activity
GO:0061578 K63-linked deubiquitinase activity
GO:0070628 proteasome binding
GO:0140492 metal-dependent deubiquitinase activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006508 proteolysis
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016579 protein deubiquitination
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045471 response to ethanol
GO:0061136 regulation of proteasomal protein catabolic process
GO:0070536 protein K63-linked deubiquitination
Cellular Component
GO:0000502 proteasome complex
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0008541 proteasome regulatory particle, lid subcomplex
GO:0022624 proteasome accessory complex
GO:0031597 cytosolic proteasome complex
GO:0034774 secretory granule lumen
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w3b, PDBe:7w3b, PDBj:7w3b
PDBsum7w3b
PubMed35477760
UniProtO00487|PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 (Gene Name=PSMD14)

[Back to BioLiP]