Structure of PDB 7tut Chain c

Receptor sequence
>7tutc (length=98) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
SLESINSRLQLVMKSGKYVLGYKQSLKMIRQGKAKLVILANNCPALRKSE
IEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLSIIDPGDSDIIRS
3D structure
PDB7tut Mechanism of an intramembrane chaperone for multipass membrane proteins.
Chainc
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c L29 G30 Y31 K32 Q33 K36 P53 A54 R56 S58 Y89 V91 C92 L20 G21 Y22 K23 Q24 K27 P44 A45 R47 S49 Y80 V82 C83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0031640 killing of cells of another organism
GO:0050829 defense response to Gram-negative bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tut, PDBe:7tut, PDBj:7tut
PDBsum7tut
PubMed36261528
UniProtG1TDL2|RL30_RABIT Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]