Structure of PDB 7syw Chain c

Receptor sequence
>7sywc (length=83) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQ
TVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
3D structure
PDB7syw Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
Chainc
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c R17 H19 K20 K21 K22 P28 S30 F32 Q51 P66 G68 G69 K70 R72 R16 H18 K19 K20 K21 P27 S29 F31 Q50 P65 G67 G68 K69 R71
BS02 rna c D34 K36 Y41 I43 R80 D33 K35 Y40 I42 R79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7syw, PDBe:7syw, PDBj:7syw
PDBsum7syw
PubMed35822879
UniProtG1TZ76|RS27_RABIT Small ribosomal subunit protein eS27 (Gene Name=RPS27)

[Back to BioLiP]