Structure of PDB 7r72 Chain c

Receptor sequence
>7r72c (length=97) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEY
YAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
3D structure
PDB7r72 Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Chainc
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c L25 G26 Y27 K28 S29 P49 R52 L84 F85 R86 V87 G88 L17 G18 Y19 K20 S21 P41 R44 L76 F77 R78 V79 G80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0030627 pre-mRNA 5'-splice site binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0048025 negative regulation of mRNA splicing, via spliceosome
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r72, PDBe:7r72, PDBj:7r72
PDBsum7r72
PubMed36482249
UniProtP14120|RL30_YEAST Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]