Structure of PDB 7qv2 Chain c

Receptor sequence

>7qv2c (length=206) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

GQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKRLSDASV
SKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHIN
ILEIKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTM
VSGRLGGADIARSEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWI
YRGEVL

3D structure

• PDB: 7qv2 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
• Chain: c
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	R130 I161 R163	R129 I160 R162
BS02	rna	c	G2 Q3 K4 V5 L10 K26 R126 S153 G154 R155 D160 I161 A162 Y166 T171 V172 P173 L174 H175 L177 R178 T191 K194 G196 K198	G1 Q2 K3 V4 L9 K25 R125 S152 G153 R154 D159 I160 A161 Y165 T170 V171 P172 L173 H174 L176 R177 T190 K193 G195 K197

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qv2, PDBe:7qv2, PDBj:7qv2
• PDBsum: 7qv2
• PubMed: 35264791
• UniProt: P21465|RS3_BACSU Small ribosomal subunit protein uS3 (Gene Name=rpsC)