Structure of PDB 7q0p Chain c

Receptor sequence
>7q0pc (length=81) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
VLVQDLLHPSPATEAKQHKLKTLVQQPRSFFMDVKCQGCLNITTVFSHAQ
TAVTCDSCSTVLCTPTGGKAKLTEGCSFRRK
3D structure
PDB7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.
Chainc
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c K17 H19 K20 L21 K22 P28 S30 H49 Q51 T67 G68 G69 K70 K72 E75 K16 H18 K19 L20 K21 P27 S29 H48 Q50 T66 G67 G68 K69 K71 E74
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
PDBsum7q0p
PubMed35613268
UniProtA0A1D8PTI7|RS27_CANAL Small ribosomal subunit protein eS27 (Gene Name=RPS27)

[Back to BioLiP]