Structure of PDB 7pkt Chain c

Receptor sequence

>7pktc (length=318) Species: 3055 (Chlamydomonas reinhardtii)

LRRVDDEALSPHPPTTDVGPLTVRYPFPIEYYKDREAVIYSLDERPLGLA
PLPGAAFNVPVRIDILHRVVRYWRAKWQQGTHKAKSRAEVSGGGKKPWNQ
KKTGRARQGSIRSPLWKGGGVSHAPRPRSHAHALPRSTRLLGMRCALSAK
INEGRFFVVDDLINLRAAPLQAAAAAAAAAAAAASNKNPARWSRHGLSPA
DRPIREYGELKRRLGALTEGSFGSSWLLVDSGEAGRDGGLRLRKLLKCSV
VMEVVSPEELTVYHVLKYHRLVVTRDALQRISEALTRPHRVTKPVKHAWW
ARRRQAIDAAVQELTQAE

3D structure

• PDB: 7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
• Chain: c
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	R158 Q162 Q163 T165 K169 V174 S175 G176 R196 K201 G202 P211 R311 Y313 K317 S330 K350 K353 S355 V356 V357	R74 Q78 Q79 T81 K85 V90 S91 G92 R112 K117 G118 P127 R205 Y207 K211 S224 K244 K247 S249 V250 V251
BS02	rna	c	P104 R146 S206 H207 R212 R220 S221 T222 H395 R396 P400 H403 W406	P20 R62 S122 H123 R128 R136 S137 T138 H289 R290 P294 H297 W300
BS03	rna	c	R152 R155 S170 R171 A172 K179 K180 Q184 R191 G193 S197 P198 S206 H207 H216 A217 L218 P219	R68 R71 S86 R87 A88 K95 K96 Q100 R107 G109 S113 P114 S122 H123 H132 A133 L134 P135
BS04	rna	c	P95 H96 H151 R155 R158 R189 A190 R191 Q192 L199 K201 P209 R212 Y369 K373	P11 H12 H67 R71 R74 R105 A106 R107 Q108 L115 K117 P125 R128 Y263 K267
BS05	rna	c	K185 T187 R191	K101 T103 R107
BS06	rna	c	Q184 K185 R191	Q100 K101 R107

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
• PDBsum: 7pkt
• PubMed: 34887394
• UniProt: A0A2K3D422