Structure of PDB 7pir Chain c

Receptor sequence

>7pirc (length=210) Species: 272634 (Mycoplasmoides pneumoniae M129)

AKLKLIKIDGSFETEPVKLSPGLIAKELKQQPVFDAVLVEQASWRQGTHS
ILTKGEVRGGGKKPYKQKHTGKARQGSTRNPHFVGGGIVFGPKPNRNYSL
KLNKKAHTAALHTVWSEKLASDNTHLVDQNLFNKTEGKTKVMMQFLKSAK
LLDKNVLFVVNTLNTNLEQSTSNIKNVQVKHLDKVSVRDLMLANALLVEK
EVLKALEGKF

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: c
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	K30 F35 L39 E41 Q42 S44 W45 R46 Q47 T49 H50 S51 I52 L53 K55 G56 E57 R59 G60 G61 K63 K64 Y66 Q68 K69 H70 T71 G72 K73 A74 R75 Q76 G77 P82 H83 F84 V85 I89 V90 F91 G92 P93 K94 N96 R97 N98 Y99 K102 N104 K105 K106 A107 H108 G138 K139 T140 K141 M144 Q170 S173 N174 K176 K181 K185 S187 D190 L193 K210	K29 F34 L38 E40 Q41 S43 W44 R45 Q46 T48 H49 S50 I51 L52 K54 G55 E56 R58 G59 G60 K62 K63 Y65 Q67 K68 H69 T70 G71 K72 A73 R74 Q75 G76 P81 H82 F83 V84 I88 V89 F90 G91 P92 K93 N95 R96 N97 Y98 K101 N103 K104 K105 A106 H107 G137 K138 T139 K140 M143 Q169 S172 N173 K175 K180 K184 S186 D189 L192 K209

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: P75579|RL4_MYCPN Large ribosomal subunit protein uL4 (Gene Name=rplD)