Structure of PDB 7pip Chain c

Receptor sequence

>7pipc (length=210) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]

AKLKLIKIDGSFETEPVKLSPGLIAKELKQQPVFDAVLVEQASWRQGTHS
ILTKGEVRGGGKKPYKQKHTGKARQGSTRNPHFVGGGIVFGPKPNRNYSL
KLNKKAHTAALHTVWSEKLASDNTHLVDQNLFNKTEGKTKVMMQFLKSAK
LLDKNVLFVVNTLNTNLEQSTSNIKNVQVKHLDKVSVRDLMLANALLVEK
EVLKALEGKF

3D structure

PDB

7pip Visualizing translation dynamics at atomic detail inside a bacterial cell.

Chain

Resolution

9.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	K30 Q32 W45 R46 Q47 G48 T49 K55 G56 R59 G60 K64 Q68 K69 H70 T71 G72 K73 A74 R75 Q76 G77 S78 R80 N81 H83 F84 V85 I89 V90 F91 G92 P93 N96 R97 Y99 K102 N104 K105 K106 A107 H108 G138 K139 T140 K141 M144 Q170 S173 N174 I175 K181 D184 K185	K29 Q31 W44 R45 Q46 G47 T48 K54 G55 R58 G59 K63 Q67 K68 H69 T70 G71 K72 A73 R74 Q75 G76 S77 R79 N80 H82 F83 V84 I88 V89 F90 G91 P92 N95 R96 Y98 K101 N103 K104 K105 A106 H107 G137 K138 T139 K140 M143 Q169 S172 N173 I174 K180 D183 K184

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0046677	response to antibiotic

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pip, PDBe:7pip, PDBj:7pip
PDBsum	7pip
PubMed	36171285
UniProt	P75579\|RL4_MYCPN Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]