Structure of PDB 7pgb Chain c |
>7pgbc (length=113) Species: 187272,246200 [Search protein sequence] |
PGIAWIALLLLVIFYVFAVMGTKLFAQSFPEWFGTLGASMYTLFQVMTLE SWSMGIARPVIEAYPWAWIYFVSFILVSSFTVLNLFIGIIIESMQSAHHA EDGERTDAYRDEV |
|
PDB | 7pgb Quaternary structure independent folding of voltage-gated ion channel pore domain subunits. |
Chain | c |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
4NB |
c |
T169 K170 G181 |
T22 K23 G34 |
|
|
|
|