Structure of PDB 7czl Chain c

Receptor sequence

>7czlc (length=446) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]

DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFI
PEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLG
FGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLV
AKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVS
VNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSL
GALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGA
NVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLD
LNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWL
ATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSL

3D structure

PDB

7czl Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus .

Chain

Resolution

3.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	c	L5168 A5172 L5175 H5237 A5278 M5282 I5285 F5289 V5296	L142 A146 L149 H211 A252 M256 I259 F263 V270
BS02	CLA	c	W5063 L5174 L5279 A5286 Y5297 H5430 L5433 F5437	W37 L148 L253 A260 Y271 H404 L407 F411
BS03	CLA	c	I5060 V5061 L5088 H5091 I5092 V5114 H5118 M5282	I34 V35 L62 H65 I66 V88 H92 M256
BS04	CLA	c	W5063 M5067 F5070 I5087 W5425	W37 M41 F44 I61 W399
BS05	CLA	c	Y5274 G5277 A5278 H5441 A5445 R5449	Y248 G251 A252 H415 A419 R423
BS06	CLA	c	L5161 L5165 A5246 G5247 W5250 H5251 T5255 P5256 F5257 W5259	L135 L139 A220 G221 W224 H225 T229 P230 F231 W233
BS07	CLA	c	M5157 L5161 H5164 L5168 W5266 Y5271 Y5274 A5278 M5282	M131 L135 H138 L142 W240 Y245 Y248 A252 M256
BS08	CLA	c	W5036 A5037 N5039 A5040 L5272 F5437 G5440 W5443 H5444 R5447	W10 A11 N13 A14 L246 F411 G414 W417 H418 R421
BS09	CLA	c	H5053 H5056 G5268 Y5271 L5272 S5275	H27 H30 G242 Y245 L246 S249
BS10	CLA	c	H5056 I5060 W5063 F5437	H30 I34 W37 F411
BS11	CLA	c	L5050 H5053 F5147 I5160 F5163 H5164	L24 H27 F121 I134 F137 H138
BS12	CLA	c	V5054 G5128 Y5131 H5132 F5147	V28 G102 Y105 H106 F121
BS13	CLA	c	N5039 R5041 L5042 K5048 A5052	N13 R15 L16 K22 A26

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009767	photosynthetic electron transport chain
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005737	cytoplasm
GO:0009521	photosystem
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7czl, PDBe:7czl, PDBj:7czl
PDBsum	7czl
PubMed	33495333
UniProt	D0VWR7\|PSBC_THEVL Photosystem II CP43 reaction center protein (Fragment) (Gene Name=psbC)

[Back to BioLiP]