Structure of PDB 7b0y Chain c

Receptor sequence

>7b0yc (length=98) Species: 9606 (Homo sapiens)

TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVE

3D structure

• PDB: 7b0y Structure of a transcribing RNA polymerase II-U1 snRNP complex.
• Chain: c
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	Y13 N15 N16 S48 K50 M51 R52 G53 F56 Y86 A87 K88 S91 D92	Y8 N10 N11 S43 K45 M46 R47 G48 F51 Y81 A82 K83 S86 D87

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030619 U1 snRNA binding
• GO:0042802 identical protein binding
• GO:1990446 U1 snRNP binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0030532 small nuclear ribonucleoprotein complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:7b0y, PDBe:7b0y, PDBj:7b0y
• PDBsum: 7b0y
• PubMed: 33446560
• UniProt: P09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)