Structure of PDB 7aqc Chain c

Receptor sequence
>7aqcc (length=48) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MRVNITLACTECGERNYISKKNKRNNPDRVEFKKYCPRDKKSTLHRET
3D structure
PDB7aqc Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
Chainc
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c R2 E14 R15 Y17 I18 S19 N22 N25 F32 K33 K34 Y35 K41 R2 E14 R15 Y17 I18 S19 N22 N25 F32 K33 K34 Y35 K41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aqc, PDBe:7aqc, PDBj:7aqc
PDBsum7aqc
PubMed33259811
UniProtP56849|RL331_BACSU Large ribosomal subunit protein bL33A (Gene Name=rpmGA)

[Back to BioLiP]