Structure of PDB 6zce Chain c

Receptor sequence
>6zcec (length=81) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQ
TAVTCESCSTILCTPTGGKAKLSEGTSFRRK
3D structure
PDB6zce A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
Chainc
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c L21 P28 P66 T67 G68 G69 L20 P27 P65 T66 G67 G68
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zce, PDBe:6zce, PDBj:6zce
PDBsum6zce
PubMed33289941
UniProtP35997|RS27A_YEAST Small ribosomal subunit protein eS27A (Gene Name=RPS27A)

[Back to BioLiP]