Structure of PDB 6ywv Chain c

Receptor sequence
>6ywvc (length=98) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]
GGLLWKIPWRMSKFQKLRQRRRLRAVDNVVATIENALAKKGETVKAVERW
RAEMPTEAEMLPKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRVNPPGY
3D structure
PDB6ywv Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
Chainc
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c G13 G14 L15 L16 W17 K18 P20 W21 R22 S24 F26 Q27 K28 R30 R32 R33 R34 R36 K57 R61 Y78 R83 K90 P96 K97 T99 R100 G1 G2 L3 L4 W5 K6 P8 W9 R10 S12 F14 Q15 K16 R18 R20 R21 R22 R24 K45 R49 Y66 R71 K78 P84 K85 T87 R88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6ywv, PDBe:6ywv, PDBj:6ywv
PDBsum6ywv
PubMed33056988
UniProtU9W8F2|RM31_NEUCR Large ribosomal subunit protein mL60 (Gene Name=mrpl31)

[Back to BioLiP]