Structure of PDB 6y7c Chain c

Receptor sequence
>6y7cc (length=63) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDIL
VLMESEREARRLR
3D structure
PDB6y7c Good Vibrations: Structural Remodeling of Maturing Yeast Pre-40S Ribosomal Particles Followed by Cryo-Electron Microscopy.
Chainc
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c R18 S21 R22 R14 S17 R18
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:1900153 positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y7c, PDBe:6y7c, PDBj:6y7c
PDBsum6y7c
PubMed32138239
UniProtQ3E7X9|RS28A_YEAST Small ribosomal subunit protein eS28A (Gene Name=RPS28A)

[Back to BioLiP]