Structure of PDB 6tnn Chain c

Receptor sequence
>6tnnc (length=142) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
TPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGD
HVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLE
LAIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chainc
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c P5 L26 G27 R28 S31 E32 K40 H48 T66 K69 Y76 R77 H78 T79 H81 G83 G108 M109 S114 L115 R117 H133 A135 Q136 P2 L23 G24 R25 S28 E29 K37 H45 T63 K66 Y73 R74 H75 T76 H78 G80 G105 M106 S111 L112 R114 H130 A132 Q133
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP70974|RL13_BACSU Large ribosomal subunit protein uL13 (Gene Name=rplM)

[Back to BioLiP]