Structure of PDB 6q95 Chain c

Receptor sequence
>6q95c (length=44) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREV
3D structure
PDB6q95 How a circularized tmRNA moves through the ribosome.
Chainc
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c L10 R19 T23 K25 K27 T30 E35 R37 K38 Y39 C40 K45 H46 L2 R11 T15 K17 K19 T22 E27 R29 K30 Y31 C32 K37 H38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q95, PDBe:6q95, PDBj:6q95
PDBsum6q95
PubMed30765567
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]