Structure of PDB 6n8o Chain c

Receptor sequence

>6n8oc (length=183) Species: 559292 (Saccharomyces cerevisiae S288C)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
• Chain: c
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	R3 A17 R18 Y21 R23 S25 F26 R30 Q34 R62 S65 S66 I67 G68 R69 A71 Q72 E75 R82 W83 K86 N97 N101 H116 Q118 V119 R127 Y130 R131 A132 H133 G134 N137 K138 Y139 E140 S141 T169 R171 Q172 G174 R175 A178 I182	R2 A16 R17 Y20 R22 S24 F25 R29 Q33 R61 S64 S65 I66 G67 R68 A70 Q71 E74 R81 W82 K85 N96 N100 H115 Q117 V118 R126 Y129 R130 A131 H132 G133 N136 K137 Y138 E139 S140 T168 R170 Q171 G173 R174 A177 I181
BS02	rna	c	R3 Y4 A6 R61 R62 Q121 P123	R2 Y3 A5 R60 R61 Q120 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
• PDBsum: 6n8o
• PubMed: 30814529
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)