Structure of PDB 6et5 Chain c

Receptor sequence
>6et5c (length=55) Species: 1079 (Blastochloris viridis) [Search protein sequence]
ADLKPSLTGLTEEEAKEFHGIFVTSTVLYLATAVIVHYLVWTARPWIAPI
PKGWV
3D structure
PDB6et5 Cryo-EM structure of the Blastochloris viridis LH1-RC complex at 2.9 angstrom.
Chainc
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide c L30 H37 W41 I47 L30 H37 W41 I47
BS02 peptide c L28 T32 V36 L28 T32 V36
BS03 BCB c Y29 T32 V36 H37 Y29 T32 V36 H37
BS04 BCB c Y29 L30 A33 H37 W46 Y29 L30 A33 H37 W46
BS05 NS0 c F18 I21 S25 T26 F18 I21 S25 T26
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6et5, PDBe:6et5, PDBj:6et5
PDBsum6et5
PubMed29618818
UniProtP04124|LHB_BLAVI Light-harvesting protein B-1015 beta chain (Gene Name=pufB)

[Back to BioLiP]