Structure of PDB 6d90 Chain c

Receptor sequence
>6d90c (length=98) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
SLESINSRLQLVMKSGKYVLGYKQSLKMIRQGKAKLVILANNCPALRKSE
IEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLSIIDPGDSDIIRS
3D structure
PDB6d90 Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
Chainc
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c L29 G30 Y31 K32 Q33 P53 A54 R56 S58 Y89 L20 G21 Y22 K23 Q24 P44 A45 R47 S49 Y80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0031640 killing of cells of another organism
GO:0050829 defense response to Gram-negative bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6d90, PDBe:6d90, PDBj:6d90
PDBsum6d90
PubMed29856316
UniProtG1TDL2|RL30_RABIT Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]