Structure of PDB 5zwo Chain c |
>5zwoc (length=90) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
ELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVL ENVKELWTEKKKNVINRERFISKLFLRGDSVIVVLKTPVE |
|
PDB | 5zwo Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation |
Chain | c |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
c |
R49 D99 |
R30 D79 |
|
|
|
|