Structure of PDB 5xnl Chain c

Receptor sequence
>5xnlc (length=450) Species: 3888 (Pisum sativum) [Search protein sequence]
TGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVA
HFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSA
VLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGSF
LLVFKAFYFGGIYDTWAPGGGDVRKITNFTLSPSILFGYLLKSPFGGEGW
IVSVDDLEDIIGGHVWLGSICILGGIWHILTKPFAWARRALVWSGEAYLS
YSLGALAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQR
LGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPN
GLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPR
SWLATSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN
3D structure
PDB5xnl Structure and assembly mechanism of plant C2S2M2-type PSII-LHCII supercomplex
Chainc
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 OEX c E354 R357 E331 R334
BS02 CLA c L95 G171 S172 L175 I233 H237 L240 F282 I285 F289 A296 Y297 L72 G148 S149 L152 I210 H214 L217 F259 I262 F266 A273 Y274
BS03 CLA c W63 H91 L174 F182 L279 F282 A286 Y297 L426 H430 L433 L437 W40 H68 L151 F159 L256 F259 A263 Y274 L403 H407 L410 L414
BS04 CLA c I60 V61 A64 L88 L92 L95 S114 H118 L279 I37 V38 A41 L65 L69 L72 S91 H95 L256
BS05 CLA c W63 M67 F70 G85 I87 W425 S429 F436 W40 M44 F47 G62 I64 W402 S406 F413
BS06 CLA c Y274 F438 H441 L442 A445 R449 Y251 F415 H418 L419 A422 R426
BS07 CLA c L161 L165 I243 G247 W250 H251 P256 F257 W259 A260 L264 L138 L142 I220 G224 W227 H228 P233 F234 W236 A237 L241
BS08 CLA c M157 L161 H164 L165 L168 C244 W266 Y271 Y274 S275 A278 L279 F282 M134 L138 H141 L142 L145 C221 W243 Y248 Y251 S252 A255 L256 F259
BS09 CLA c W36 A37 N39 A40 L272 L276 F436 L437 G440 W443 H444 R447 W13 A14 N16 A17 L249 L253 F413 L414 G417 W420 H421 R424
BS10 CLA c N39 I43 L49 A52 H53 H56 Y149 W151 H164 G268 E269 Y271 L272 S275 L279 N16 I20 L26 A29 H30 H33 Y126 W128 H141 G245 E246 Y248 L249 S252 L256
BS11 CLA c N39 H56 L59 I60 W63 N16 H33 L36 I37 W40
BS12 CLA c R26 W35 G38 N39 R41 L42 A52 I130 A133 R3 W12 G15 N16 R18 L19 A29 I107 A110
BS13 CLA c H53 F147 Y149 I160 I163 H164 L167 H30 F124 Y126 I137 I140 H141 L144
BS14 CLA c L50 V54 V124 L125 G128 Y131 H132 L140 F144 F147 L27 V31 V101 L102 G105 Y108 H109 L117 F121 F124
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009521 photosystem
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xnl, PDBe:5xnl, PDBj:5xnl
PDBsum5xnl
PubMed28839073
UniProtP06004|PSBC_PEA Photosystem II CP43 reaction center protein (Gene Name=psbC)

[Back to BioLiP]