Structure of PDB 5mrf Chain c

Receptor sequence

>5mrfc (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GGLLWKIPWRMSTHQKTRQRERLRNVDQVIKQLTLGLHVQRCQDKGLTYQ
EAMESKKKYKPRSKSLRLLNKPSVFPKENQMSSKDKYWTFDKKAVGYRKG
IHKVPKWTKISIRKAPKFF

3D structure

PDB

5mrf The structure of the yeast mitochondrial ribosome.

Chain

Resolution

4.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	G13 G14 L15 L16 W17 K18 P20 W21 R22 S24 H26 Q27 K28 R30 R32 R34 R53 K57 K69 Y71 K72 R74 S75 K76 R79 L80 K83 S85 Q92 S94 S95 K98 Y99 K104 K105 K111 P117 K118 T120 K121	G1 G2 L3 L4 W5 K6 P8 W9 R10 S12 H14 Q15 K16 R18 R20 R22 R41 K45 K57 Y59 K60 R62 S63 K64 R67 L68 K71 S73 Q80 S82 S83 K86 Y87 K92 K93 K99 P105 K106 T108 K109

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5mrf, PDBe:5mrf, PDBj:5mrf
PDBsum	5mrf
PubMed	28154081
UniProt	P14063\|RM31_YEAST Large ribosomal subunit protein mL60 (Gene Name=MRPL31)