Structure of PDB 5mdx Chain c

Receptor sequence

>5mdxc (length=433) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

AGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVA
HFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSA
VLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAF
LLVFKALYFGGVYDTWAPGGGDVRKITNLTLSPSVIFGYLLKSPFGGEGW
IVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLS
YSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQR
LGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPN
GLDLSRLKKDIQPWQERRSAEYMTHAPVNYVSPRSWLSTSHFVLGFFLFV
GHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPL

3D structure

PDB

5mdx Subunit and chlorophyll organization of the plant photosystem II supercomplex.

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	c	W63 H91 L279 L426 H430 L433 L437	W40 H68 L256 L387 H391 L394 L398
BS02	CLA	c	V61 L88 H118	V38 L65 H95
BS03	CLA	c	L95 L175 I233 H237 L240 F289 Y297	L72 L152 I210 H214 L217 F266 Y274
BS04	CLA	c	W63 G85	W40 G62
BS05	CLA	c	Y274 F438 H441 A445 R449	Y251 F399 H402 A406 R410
BS06	CLA	c	L165 I243 G247 W250 H251 F257	L142 I220 G224 W227 H228 F234
BS07	CLA	c	M157 L161 H164 W266 Y271 Y274 S275	M134 L138 H141 W243 Y248 Y251 S252
BS08	CLA	c	W36 A37 N39 E269 L272 F436 G440 W443 H444 R447	W13 A14 N16 E246 L249 F397 G401 W404 H405 R408
BS09	CLA	c	N39 I43 L49 H53 H56 L272 S275	N16 I20 L26 H30 H33 L249 S252
BS10	CLA	c	H56 I60	H33 I37
BS11	CLA	c	G25 W35 G38 N39 L42 L45	G2 W12 G15 N16 L19 L22
BS12	CLA	c	F146 I160 I163 H164	F123 I137 I140 H141
BS13	CLA	c	L50 G128 Y131 H132 F144 F147	L27 G105 Y108 H109 F121 F124

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0016168	chlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009767	photosynthetic electron transport chain
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005737	cytoplasm
GO:0009507	chloroplast
GO:0009521	photosystem
GO:0009523	photosystem II
GO:0009533	chloroplast stromal thylakoid
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009536	plastid
GO:0009539	photosystem II reaction center
GO:0009579	thylakoid
GO:0010287	plastoglobule
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mdx, PDBe:5mdx, PDBj:5mdx
PDBsum	5mdx
PubMed	28604725
UniProt	P56778\|PSBC_ARATH Photosystem II CP43 reaction center protein (Gene Name=psbC)

[Back to BioLiP]