Structure of PDB 5imq Chain c

Receptor sequence

>5imqc (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

EVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTK
TRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLP
KKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSE
SVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVF
QNRIGGEA

3D structure

PDB

5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	c	H31 W34 Q40 A42 R44 R45 R46 T48 K52 T53 R54 V57 Y59 G61 R62 K63 Q67 H69 R72 R74 P81 I82 F83 V84 V89 F90 R95 Y99 T100 P102 K103 V105 R106 K108 K135 T136 K137 R165 R168 L170 P171 P178 N182	H29 W32 Q38 A40 R42 R43 R44 T46 K50 T51 R52 V55 Y57 G59 R60 K61 Q65 H67 R70 R72 P79 I80 F81 V82 V87 F88 R93 Y97 T98 P100 K101 V103 R104 K106 K133 T134 K135 R163 R166 L168 P169 P176 N180

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum	5imq
PubMed	27137929
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]