Structure of PDB 5gti Chain c

Receptor sequence
>5gtic (length=455) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
NSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMT
LFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVH
LISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVL
GIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPF
GGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSG
EAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFL
IRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEP
LRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVN
FVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLS
MPSLD
3D structure
PDB5gti Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
Chainc
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 OEX c E354 R357 E336 R339
BS02 CLA c L168 G171 A172 L175 H237 I240 M282 F289 Y297 L150 G153 A154 L157 H219 I222 M264 F271 Y279
BS03 CLA c W63 H91 L174 L279 M282 A286 Y297 H430 L433 F437 W45 H73 L156 L261 M264 A268 Y279 H412 L415 F419
BS04 CLA c I60 V61 L88 H91 V114 H118 I42 V43 L70 H73 V96 H100
BS05 CLA c W63 M67 F70 G85 I87 W425 S429 F436 W45 M49 F52 G67 I69 W407 S411 F418
BS06 CLA c Y274 M281 L438 H441 L442 A445 R449 Y256 M263 L420 H423 L424 A427 R431
BS07 CLA c L161 L165 L213 I243 G247 W250 H251 F257 W259 F264 L143 L147 L195 I225 G229 W232 H233 F239 W241 F246
BS08 CLA c M157 L161 H164 L168 F264 W266 Y271 Y274 S275 M282 M139 L143 H146 L150 F246 W248 Y253 Y256 S257 M264
BS09 CLA c W36 A37 N39 L272 L276 F436 F437 G440 W443 H444 R447 W18 A19 N21 L254 L258 F418 F419 G422 W425 H426 R429
BS10 CLA c N39 L49 A52 H53 H56 Y149 W151 Y271 L272 S275 N21 L31 A34 H35 H38 Y131 W133 Y253 L254 S257
BS11 CLA c H56 L59 F436 F437 H38 L41 F418 F419
BS12 CLA c R26 W35 G38 N39 R41 L42 K48 A52 F127 I134 R8 W17 G20 N21 R23 L24 K30 A34 F109 I116
BS13 CLA c H53 F146 F147 F163 H164 V167 L174 H35 F128 F129 F145 H146 V149 L156
BS14 CLA c L50 V54 V124 G128 Y131 H132 P137 Y143 F147 L32 V36 V106 G110 Y113 H114 P119 Y125 F129
BS15 CA c N155 T158 T159 H251 I252 T254 N137 T140 T141 H233 I234 T236
BS16 CA c F22 T24 D27 E29 S30 F4 T6 D9 E11 S12
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009521 photosystem
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gti, PDBe:5gti, PDBj:5gti
PDBsum5gti
PubMed28219079
UniProtD0VWR7|PSBC_THEVL Photosystem II CP43 reaction center protein (Fragment) (Gene Name=psbC)

[Back to BioLiP]