Structure of PDB 4fby Chain c

Receptor sequence
>4fbyc (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB4fby Room temperature femtosecond X-ray diffraction of photosystem II microcrystals.
Chainc
Resolution6.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide c P20 D23 V24 I28 L35 P11 D14 V15 I19 L26
BS02 CLA c P29 L33 P20 L24
BS03 CLA c F32 W39 Q40 F23 W30 Q31
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fby, PDBe:4fby, PDBj:4fby
PDBsum4fby
PubMed22665786
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]