Structure of PDB 3j81 Chain c

Receptor sequence
>3j81c (length=62) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
PVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDILV
LMESEREARRLR
3D structure
PDB3j81 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
Chainc
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna c R18 S21 R22 P47 R13 S16 R17 P42
BS02 rna c R64 R67 R59 R62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j81, PDBe:3j81, PDBj:3j81
PDBsum3j81
PubMed25417110
UniProtP33285|RS28_KLULA Small ribosomal subunit protein eS28 (Gene Name=RPS28)

[Back to BioLiP]