Structure of PDB 5y6p Chain bz

Receptor sequence
>5y6pbz (length=177) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
MLDAFSRVVVNSDSKAAYVGGSDLQSLKTFISDGNKRLDAVNCIVSNASC
IVSDAISGMICENPGLIAPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DSSVLDDRCLNGLKETYIALGVPTASTSRAVSIMKAASTAFIMNTASGRK
IEIAAGDCQALQSEAAAYFDKVGSAVD
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
Chainbz
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 PEB bz C73 R78 A81 C82 R84 D85 L120 P123 C73 R78 A81 C82 R84 D85 L120 P123
BS02 PEB bz N35 K36 I153 G156 N35 K36 I153 G156
BS03 PUB bz C50 D54 S57 G58 C61 A136 S147 G148 C50 D54 S57 G58 C61 A136 S147 G148
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Nov 28 14:44:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'bz', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='bz', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'bz'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='bz')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>