Structure of PDB 8ip8 Chain bl

Receptor sequence

>8ip8bl (length=437) Species: 4565 (Triticum aestivum)

MSDSHETDKNIEMWKIKKLIKGLESARGNGTSMISLIMPPRDQVSRVTKM
LGDEYGTASNIKSRVNRQSVLGAITSAQQRLKLYNRVPPNGLVLYTGTIV
TDDGKEKKVTIDFEPFKPINASLYLCDNKFHTEALSELLESDDKFGFIIM
DGNGTLFGTLSGNTREVLHKFSVDLPKKHGRGGQSALRFARLRMEKRHNY
VRKTAELATQFFINPATSQPNVAGLILAGSADFKTELSQSDMFDQRLQCK
ILNVVDVSYGGESGFNQAIELSAEILANVKFIQEKKLIGKYFEEISQDTG
KYVFGVDDTLKALEMGAVETLMVWENLDVNRFVLKHSATGEIIIKHLNKE
GEADQSNFRDPSTNAELEVQEKTSLLEWFANEYKKFGCTLEFVTNKSQEG
SQFCRGFGGIGGILRYQLDIRSFDDLDDDEGVYEDSD

3D structure

• PDB: 8ip8 Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
• Chain: bl
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	bl	K62 R64 Q79 L125 C126	K62 R64 Q79 L125 C126
BS02	rna	bl	R41 R46 N120 A121 S122 G152 N153 K177 K178 H179 G180 R181 G183 Q184 R188 F189 R191 L192 R197 R202 S230 A231 F233 S296 Q297 Q417	R41 R46 N120 A121 S122 G152 N153 K177 K178 H179 G180 R181 G183 Q184 R188 F189 R191 L192 R197 R202 S230 A231 F233 S296 Q297 Q417
BS03	rna	bl	T31 T57 N60 I61 K62	T31 T57 N60 I61 K62
BS04	rna	bl	S45 K49 G182	S45 K49 G182

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific
• GO:1990825 sequence-specific mRNA binding

Biological Process

• GO:0002184 cytoplasmic translational termination
• GO:0006412 translation
• GO:0006415 translational termination
• GO:0060255 regulation of macromolecule metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0018444 translation release factor complex

External links

• PDB: RCSB:8ip8, PDBe:8ip8, PDBj:8ip8
• PDBsum: 8ip8
• PubMed: 38267667
• UniProt: I3NM28