Structure of PDB 8rd8 Chain bk

Receptor sequence
>8rd8bk (length=49) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
RDKIKLVSTAGTGYYYTTTKNKRTMPGKMEMKKFDPKIRQHVLFKEAKI
3D structure
PDB8rd8 A new family of bacterial ribosome hibernation factors
Chainbk
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna bk R2 K4 G14 Y16 Y17 T19 T20 K21 N22 M32 K33 F35 P37 R40 H42 R1 K3 G13 Y15 Y16 T18 T19 K20 N21 M31 K32 F34 P36 R39 H41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum8rd8
PubMed38355796
UniProtA0A0M4SWV1

[Back to BioLiP]