Structure of PDB 7o0v Chain bh

Receptor sequence
>7o0vbh (length=39) Species: 1379270 (Gemmatimonas phototrophica) [Search protein sequence]
GMTEEEARRFHGYMVTGTLGYVVVASVAHFLAWSWRPWF
3D structure
PDB7o0v 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
Chainbh
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL bh Y26 V29 A30 A33 H34 Y21 V24 A25 A28 H29
BS02 0V9 bh A33 W40 A28 W35
BS03 V7N bh R14 Y18 G22 T23 Y26 R9 Y13 G17 T18 Y21
BS04 0V9 bh A30 S31 H34 F44 A25 S26 H29 F39
BS05 BCL bh Y26 A30 H34 W43 Y21 A25 H29 W38
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o0v, PDBe:7o0v, PDBj:7o0v
PDBsum7o0v
PubMed35171663
UniProtA0A143BHS8

[Back to BioLiP]