Structure of PDB 8ipb Chain bb

Receptor sequence

>8ipbbb (length=211) Species: 4565 (Triticum aestivum) [Search protein sequence]

PFTKKQWYDIKAPLLFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLAD
LQNDEDQAYRKIRLRAEDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIE
AHVDVKTTDNYMLRMFAIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEIM
VNQAASCDLKELVNKFIPEVIGKEIEKATSSIFPLQNVYVRKVKILKAPK
FDLGKLMEVHG

3D structure

PDB

8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	bb	K55 V65 R85 V114 R115 K116 W117 Q118 T119 L120 H124 R136 F138 R146 N148 Q149 V150 K151 Y155 Q157 A158 S159 Q160 R165 K199 S203 I204 F205 K216	K33 V43 R63 V92 R93 K94 W95 Q96 T97 L98 H102 R114 F116 R124 N126 Q127 V128 K129 Y133 Q135 A136 S137 Q138 R143 K177 S181 I182 F183 K194

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ipb, PDBe:8ipb, PDBj:8ipb
PDBsum	8ipb
PubMed	38267667
UniProt	A0A3B6IU74

[Back to BioLiP]