Structure of PDB 6kmx Chain bM

Receptor sequence

>6kmxbM (length=31) Species: 1641165 (Halomicronema hongdechloris C2206)

MTLSETQVFVALVIALVPAILAFRLSTELYK

3D structure

• PDB: 6kmx Structural basis for the adaptation and function of chlorophyll f in photosystem I.
• Chain: bM
• Resolution: 2.41 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	bM	S26 Y30	S26 Y30
BS02	CLA	bM	A11 L12	A11 L12

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 02:55:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kmx', asym_id = 'bM', title = 'Structural basis for the adaptation and function of chlorophyll f in photosystem I.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kmx', asym_id='bM', title='Structural basis for the adaptation and function of chlorophyll f in photosystem I.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979', uniprot = '', pdbid = '6kmx', asym_id = 'bM'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979', uniprot='', pdbid='6kmx', asym_id='bM')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>