Structure of PDB 7f4v Chain bL

Receptor sequence

>7f4vbL (length=129) Species: 251221 (Gloeobacter violaceus PCC 7421) [Search protein sequence]

LLTPVNNSTAIRWFIDNLPINRVGMDEFTRGLEIGMAHGYWLIGPFALLG
PLRNTELGLVAGLVSTIGLLLISTIGLSGYASLVEDVPTEFDRKGWSRLA
GGFLVGGVGGAIFAFAILQFFPLVSAIAR

3D structure

PDB

7f4v Structural basis for the absence of low-energy chlorophylls responsible for photoprotection from a primitive cyanobacterial PSI

Chain

Resolution

2.04 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	bL	L17 P20	L1 P4
BS02	CLA	bL	T19 V21 N22	T3 V5 N6
BS03	CLA	bL	P61 F62 L65 P67 R69	P45 F46 L49 P51 R53
BS04	CLA	bL	I88 I91 G92	I72 I75 G76
BS05	CLA	bL	P67 S81	P51 S65
BS06	CLA	bL	F30 N33 R38 E49 M52 A53	F14 N17 R22 E33 M36 A37
BS07	CLA	bL	P35 I36 I50 H54 W57	P19 I20 I34 H38 W41
BS08	CLA	bL	Y56 W57 G60 P61 L64 A130 L134	Y40 W41 G44 P45 L48 A114 L118
BS09	CLA	bL	L87 T90 I91 S94	L71 T74 I75 S78

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0005886	plasma membrane
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center

External links

PDB	RCSB:7f4v, PDBe:7f4v, PDBj:7f4v
PDBsum	7f4v
PubMed
UniProt	Q7NIE7\|PSAL_GLOVI Photosystem I reaction center subunit XI (Gene Name=psaL)