Structure of PDB 7dr2 Chain bL

Receptor sequence

>7dr2bL (length=131) Species: 2762 (Cyanophora paradoxa)

IGHLSTPISNSSAVNGLLANLPAYRKGLTPRLRGLEIGMAHGYFLTGPFV
ELGPLRNTDGGILYGSLSAVGLVVILTACLALYGKANFSGSSKSKDATLW
ESGEGWSDFVSGWLIGGAGSVGFAYLLLQYI

3D structure

• PDB: 7dr2 Structural insights into an evolutionary turning-point of photosystem I from prokaryotes to eukaryotes
• Chain: bL
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	bL	N34 L35 R39 E50 M53	N20 L21 R25 E36 M39
BS02	CLA	bL	P62 F63 L66 G67 P68	P48 F49 L52 G53 P54
BS03	CLA	bL	L59 L90	L45 L76
BS04	CLA	bL	P68 Y78 L81 S82 G85	P54 Y64 L67 S68 G71
BS05	CLA	bL	I89 Y97	I75 Y83
BS06	CLA	bL	L35 P36 A37 I51 A54 H55 F58	L21 P22 A23 I37 A40 H41 F44
BS07	CLA	bL	Y57 F58 G61 P62 L142	Y43 F44 G47 P48 L128

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 14:08:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7dr2', asym_id = 'bL', title = 'Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7dr2', asym_id='bL', title='Structural insights into an evolutionary turning...t of photosystem I from prokaryotes to eukaryotes')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0009538,0015979', uniprot = '', pdbid = '7dr2', asym_id = 'bL'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009538,0015979', uniprot='', pdbid='7dr2', asym_id='bL')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>