Structure of PDB 6jeo Chain bL

Receptor sequence

>6jeobL (length=161) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]

LPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLPAYRPGLTPF
RRGLEVGMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGLVVLFTLALS
LYANSNPPTALASVTVPNPPDAFQSKEGWNNFASAFLIGGIGGAVVAYFL
TSNLALIQGLV

3D structure

PDB

6jeo Structure of a cyanobacterial photosystem I tetramer revealed by cryo-electron microscopy.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	bL	V21 T35	V11 T25
BS02	CLA	bL	T35 V37 N38 V43 F46 I47	T25 V27 N28 V33 F36 I37
BS03	CLA	bL	P77 F78 L81 P83	P67 F68 L71 P73
BS04	CLA	bL	F105 A108	F95 A98
BS05	CLA	bL	P83 A93 G100	P73 A83 G90
BS06	CLA	bL	L170 V171	L160 V161
BS07	CLA	bL	L11 P12 S13	L1 P2 S3
BS08	CLA	bL	N49 R54 E65	N39 R44 E55
BS09	CLA	bL	L50 P51 A52 H70 F73	L40 P41 A42 H60 F63
BS10	CLA	bL	Y72 F73 G76 L160 T161	Y62 F63 G66 L150 T151

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6jeo, PDBe:6jeo, PDBj:6jeo
PDBsum	6jeo
PubMed	31666526
UniProt	P58577\|PSAL_NOSS1 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]