Structure of PDB 6jeo Chain bK

Receptor sequence
>6jeobK (length=66) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
WSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLAT
TAFGHILGVGLVLGLH
3D structure
PDB6jeo Structure of a cyanobacterial photosystem I tetramer revealed by cryo-electron microscopy.
ChainbK
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA bK L63 A64 L48 A49
BS02 CLA bK K40 Y41 P42 K25 Y26 P27
BS03 CLA bK I26 A27 I30 H70 I11 A12 I15 H55
BS04 CLA bK L76 G79 L61 G64
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jeo, PDBe:6jeo, PDBj:6jeo
PDBsum6jeo
PubMed31666526
UniProtP58583|PSAK1_NOSS1 Photosystem I reaction center subunit PsaK 1 (Gene Name=psaK1)

[Back to BioLiP]