Structure of PDB 7dr2 Chain bI

Receptor sequence
>7dr2bI (length=30) Species: 2762 (Cyanophora paradoxa) [Search protein sequence]
NLPSILVPMVGIVLPAIVMALLFVYIETDE
3D structure
PDB7dr2 Structural insights into an evolutionary turning-point of photosystem I from prokaryotes to eukaryotes
ChainbI
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA bI L5 P6 L9 V10 V13 L2 P3 L6 V7 V10
BS02 CLA bI P11 G14 I15 P8 G11 I12
BS03 CLA bI N4 I8 N1 I5
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0009842 cyanelle
GO:0016020 membrane
GO:0033115 cyanelle thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dr2, PDBe:7dr2, PDBj:7dr2
PDBsum7dr2
PubMed
UniProtP48116|PSAI_CYAPA Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]