Structure of PDB 6k33 Chain bF

Receptor sequence

>6k33bF (length=141) Species: 32053 (Thermostichus vulcanus)

DVAGLVPCKDSPAFQKRAAAAVNTTADPASGQKRFERYSQALCGEDGLPH
LVVDGRLSRAGDFLIPSVLFLYIAGWIGWVGRAYLIAVRNSGEANEKEII
IDVPLAIKCMLTGFAWPLAALKELASGELTAKDNEITVSPR

3D structure

• PDB: 6k33 Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.
• Chain: bF
• Resolution: 2.74 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	bF	D54 R56	D54 R56
BS02	CLA	bF	F63 S67 F70 L71 A74	F63 S67 F70 L71 A74
BS03	CLA	bF	V53 F63	V53 F63
BS04	CLA	bF	W76 I77 V80 M110	W76 I77 V80 M110

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 04:31:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6k33', asym_id = 'bF', title = 'Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6k33', asym_id='bF', title='Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009522,0009538,0015979', uniprot = '', pdbid = '6k33', asym_id = 'bF'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0009538,0015979', uniprot='', pdbid='6k33', asym_id='bF')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>