Structure of PDB 7f4v Chain bC

Receptor sequence

>7f4vbC (length=80) Species: 251221 (Gloeobacter violaceus PCC 7421)

SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGNKAGTIASSPRTEDCVGC
KRCETACPTDFLSIRVYLGAETTRSMGLAY

3D structure

• PDB: 7f4v Structural basis for the absence of low-energy chlorophylls responsible for photoprotection from a primitive cyanobacterial PSI
• Chain: bC
• Resolution: 2.04 Å

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	bC	C21 V25 C48 V49 G50 C51 K52 R53 C54 V67	C20 V24 C47 V48 G49 C50 K51 R52 C53 V66
BS02	SF4	bC	C11 I12 C14 T15 C17 C58 P59 S64 I65	C10 I11 C13 T14 C16 C57 P58 S63 I64

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0005886 plasma membrane
• GO:0009522 photosystem I
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7f4v, PDBe:7f4v, PDBj:7f4v
• PDBsum: 7f4v
• UniProt: Q7NG86|PSAC_GLOVI Photosystem I iron-sulfur center (Gene Name=psaC)