Structure of PDB 7vot Chain b9

Receptor sequence
>7votb9 (length=54) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
MSKFYKIWMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEISAAK
YNRV
3D structure
PDB7vot Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
Chainb9
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 BCL b9 I7 F23 I31 I7 F23 I31
BS02 SPO b9 F4 K6 I7 F4 K6 I7
BS03 SPO b9 F25 H32 F25 H32
BS04 BCL b9 F25 A28 H32 W43 F25 A28 H32 W43
BS05 SPO b9 Q20 F23 L24 L27 M30 Q20 F23 L24 L27 M30
BS06 BCL b9 L27 A28 I31 H32 L35 Y41 L27 A28 I31 H32 L35 Y41
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7vot, PDBe:7vot, PDBj:7vot
PDBsum7vot
PubMed35418573
UniProtQ3J1A4|LHA1_CERS4 Light-harvesting protein B-875 alpha chain (Gene Name=pufA)

[Back to BioLiP]