Structure of PDB 6kgx Chain b4

Receptor sequence
>6kgxb4 (length=323) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
LTLPGTAETNLAVPSNAVRKVQPYPIAKPPSYSSVDSLRPARVSRMDADW
ATIYEQVRRQVMGNAYVMEGEAPDIDVAFSQLKGGNLTVREFVRAVGKSA
SYRTRFMEAKSSYNFVLLNFKHFLGRAPTQEEVSTHIQILATSGLEAEID
SYIDSDEYKALFGDHVVPYVVYRGTYLSSERFNRMVKANPGGATSDKAKS
NLNMIATVAADLPTDAIDVMRGLPSPITSETLAFGTAYYWAKVEKEASEG
RSASPIGEKIGKFDHAPISTYTSLCSYDKVNKAPQISVTNVGSDEHSYVS
VTSKYIAPDMAAAAQMLADCQKY
3D structure
PDB6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.
Chainb4
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB b4 A92 Y93 A220 K224 A65 Y66 A193 K197
BS02 PEB b4 S139 S161 I164 S112 S134 I137
BS03 PEB b4 S107 Q108 G111 S80 Q81 G84
BS04 PEB b4 S60 S61 V62 G201 T202 Y203 F209 S33 S34 V35 G174 T175 Y176 F182
BS05 PEB b4 L38 V40 P41 L11 V13 P14
BS06 PEB b4 H292 A293 V307 N308 H265 A266 V280 N281
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 02:47:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kgx', asym_id = 'b4', title = 'Structural basis of energy transfer in Porphyridium purpureum phycobilisome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kgx', asym_id='b4', title='Structural basis of energy transfer in Porphyridium purpureum phycobilisome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '6kgx', asym_id = 'b4'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='6kgx', asym_id='b4')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>