Structure of PDB 7oyb Chain b2

Receptor sequence

>7oybb2 (length=81) Species: 7955 (Danio rerio) [Search protein sequence]

PLAKDLLHPTPEEERRRHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQ
TVVLCVGCSTVLCQPTGGKARLTEGCSFRRK

3D structure

PDB

7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	b2	R17 H19 K21 K22 P28 S30 F32 F47 H49 Q51 P66 T67 G68 G69 K70	R16 H18 K20 K21 P27 S29 F31 F46 H48 Q50 P65 T66 G67 G68 K69

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0046872	metal ion binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation
GO:0030218	erythrocyte differentiation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links