Structure of PDB 6q9e Chain b2

Receptor sequence

>6q9eb2 (length=378) Species: 9940 (Ovis aries)

INIRKTHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFL
AMHYTPDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRG
LYYGSYTFLETWNIGVILLFATMATAFMGYVLPWGQMSFWGATVITNLLS
AIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFIFPFIIAALAMVHLLFLH
ETGSNNPTGIPSDTDKIPFHPYYTIKDILGAILLILILMLLVLFTPDLLG
DPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILVL
VIMPLLHTSKQRSMMFRPISQCMFWILVADLLTLTWIGGQPVEHPYIIIG
QLASIMYFLIILVMMPVASIIENNLLKW

3D structure

• PDB: 6q9e Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
• Chain: b2
• Resolution: 3.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H201 S205 K227 D228 E271
• Catalytic site (residue number reindexed from 1): H200 S204 K226 D227 E270

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	b2	G48 R80 H83 A87 G130 P134 H182 F183 P186	G47 R79 H82 A86 G129 P133 H181 F182 P185
BS02	HEM	b2	W31 G34 L37 H97 R100 S106 W113 G116 V117 L119 H196 L200 N206	W30 G33 L36 H96 R99 S105 W112 G115 V116 L118 H195 L199 N205
BS03	U10	b2	L21 S35 M194 L197 H201 F220	L20 S34 M193 L196 H200 F219

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:6q9e, PDBe:6q9e, PDBj:6q9e
• PDBsum: 6q9e
• PubMed: 31492636
• UniProt: P24959|CYB_SHEEP Cytochrome b (Gene Name=MT-CYB)